Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial APT protein

This Bacterial APT protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyltransferase, APRT, EC 2.4.2.7

UniProt

P63546

Expression Region

1-172aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Streptococcus pyogenes serotype M1

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-172aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE1 Protein Lysate
OCOA13435-20UG 20 µg

PAGE1 Protein Lysate

Sign In for Pricing
View Details
Odf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7198507 1.0 µg DNA

Odf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Phospho-CDC25A (Ser75) Antibody
MBS8511435-01 0.05 mg

Phospho-CDC25A (Ser75) Antibody

Sign In for Pricing
View Details
Phospho-CDC25A (Ser75) Antibody
MBS8511435-02 0.1 mg

Phospho-CDC25A (Ser75) Antibody

Sign In for Pricing
View Details
Phospho-CDC25A (Ser75) Antibody
MBS8511435-03 0.1 mL (AF750)

Phospho-CDC25A (Ser75) Antibody

Sign In for Pricing
View Details
Phospho-CDC25A (Ser75) Antibody
MBS8511435-04 0.1 mL (AF405M)

Phospho-CDC25A (Ser75) Antibody

Sign In for Pricing
View Details