Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D protein

This Human LY6G6D protein spans the amino acid sequence from region 10-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Megakaryocyte-enhanced gene transcript 1 protein

UniProt

O95868

Expression Region

10-104aa

Tag

N-terminal 10xHis-B2M-JD-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 10-104aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cadherin-6/KCAD MAb (Clone 427903)
MAB27151-SP 25 µg

Human Cadherin-6/KCAD MAb (Clone 427903)

Sign In for Pricing
View Details
Mupp1 (MPDZ) Human qPCR Primer Pair (NM_003829)
HP207281 200 Reactions

Mupp1 (MPDZ) Human qPCR Primer Pair (NM_003829)

Sign In for Pricing
View Details
SNORD45B Adenovirus (Human)
44880051 1.0 mL

SNORD45B Adenovirus (Human)

Sign In for Pricing
View Details
CT47A8 CytoSection
TS419281P5 25 Slides

CT47A8 CytoSection

Sign In for Pricing
View Details
Recombinant Antheraea yamamai Yamamarin
MBS1233931-01 0.05 mg (E-Coli)

Recombinant Antheraea yamamai Yamamarin

Sign In for Pricing
View Details
Recombinant Antheraea yamamai Yamamarin
MBS1233931-02 0.2 mg (E-Coli)

Recombinant Antheraea yamamai Yamamarin

Sign In for Pricing
View Details