Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D protein

This Human LY6G6D protein spans the amino acid sequence from region 10-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Megakaryocyte-enhanced gene transcript 1 protein

UniProt

O95868

Expression Region

10-104aa

Tag

N-terminal 10xHis-B2M-JD-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 10-104aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMM50 (Sorting and Assembly Machinery Component 50 Homolog, SAM50, CGI-51, Transformation-related Gene 3 Protein, TRG3, TRG-3) (FITC)
132961-FITC 100 µL

SAMM50 (Sorting and Assembly Machinery Component 50 Homolog, SAM50, CGI-51, Transformation-related Gene 3 Protein, TRG3, TRG-3) (FITC)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS631932 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
MTT5
orb2663679-01 10 mg

MTT5

Sign In for Pricing
View Details
MTT5
orb2663679-02 50 mg

MTT5

Sign In for Pricing
View Details
Mouse Monoclonal Granulocyte Marker Antibody (SPM250) [DyLight 350]
NBP2-34750UV 0.1 mL

Mouse Monoclonal Granulocyte Marker Antibody (SPM250) [DyLight 350]

Sign In for Pricing
View Details
TRAM2 Polyclonal Antibody, FITC Conjugated
A64848-100 100 µL

TRAM2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details