Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse EGFL8 protein

This Mouse EGFL8 protein spans the amino acid sequence from region 29-293aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ng3

UniProt

Q6GUQ1

Expression Region

29-293aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 29-293aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHFPL5 3'UTR Luciferase Stable Cell Line
TU012438 1.0 mL

LHFPL5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (MaxLight 490)
MBS6382987-01 0.1 mL

Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (MaxLight 490)

Sign In for Pricing
View Details
Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (MaxLight 490)
MBS6382987-02 5x 0.1 mL

Interleukin 20 (Interleukin-20, IL-20, IL20, Cytokine Zcyto10, IL10D, MGC96907, UNQ852/PRO1801, ZCYTO10) (MaxLight 490)

Sign In for Pricing
View Details
Lgr5 ORF Vector (Rat) (pORF)
ORF069367 1.0 µg DNA

Lgr5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
7,4'-Dihydroxy-6,8-diprenylflavanone
orb1681190 5 mg

7,4'-Dihydroxy-6,8-diprenylflavanone

Sign In for Pricing
View Details
OR4K17 Antibody
MBS9508234-01 0.05 mL

OR4K17 Antibody

Sign In for Pricing
View Details