Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse EGFL8 protein

This Mouse EGFL8 protein spans the amino acid sequence from region 29-293aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ng3

UniProt

Q6GUQ1

Expression Region

29-293aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 29-293aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA-directed RNA polymerase III subunit RPC8 (POLR3H) Human ELISA Kit
C9651 96 Tests

DNA-directed RNA polymerase III subunit RPC8 (POLR3H) Human ELISA Kit

Sign In for Pricing
View Details
Acidic CK Antibody
orb1338725 100 µg

Acidic CK Antibody

Sign In for Pricing
View Details
Recombinant Bovine Glycolipid transfer protein (GLTP)
orb1650419-01 20 µg

Recombinant Bovine Glycolipid transfer protein (GLTP)

Sign In for Pricing
View Details
Recombinant Bovine Glycolipid transfer protein (GLTP)
orb1650419-02 100 µg

Recombinant Bovine Glycolipid transfer protein (GLTP)

Sign In for Pricing
View Details
Recombinant Bovine Glycolipid transfer protein (GLTP)
orb1650419-03 1 mg

Recombinant Bovine Glycolipid transfer protein (GLTP)

Sign In for Pricing
View Details
Recombinant Mouse CXADR Protein (His tag)
ARP7151-01 10 µg

Recombinant Mouse CXADR Protein (His tag)

Sign In for Pricing
View Details