Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPI1 protein

This Human SPI1 protein spans the amino acid sequence from region 1-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

31KDA-transforming protein

UniProt

P17947

Expression Region

1-270aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-270aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT7B Rabbit Polyclonal Antibody (Biotin)
orb2124022 100 µL

WNT7B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DPM1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
18538124 3x 1.0µg DNA

DPM1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
RMI1 Polyclonal Antibody
A67578-100 100 µL

RMI1 Polyclonal Antibody

Sign In for Pricing
View Details
Goat anti-SH2-B/SH2B1 (isoform2) Antibody
MBS420824-01 0.1 mg

Goat anti-SH2-B/SH2B1 (isoform2) Antibody

Sign In for Pricing
View Details
Goat anti-SH2-B/SH2B1 (isoform2) Antibody
MBS420824-02 5x 0.1 mg

Goat anti-SH2-B/SH2B1 (isoform2) Antibody

Sign In for Pricing
View Details
Olr1632 Protein Vector (Rat) (pPB-C-His)
PV288810 500 ng

Olr1632 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details