Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPI1 protein

This Human SPI1 protein spans the amino acid sequence from region 1-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

31KDA-transforming protein

UniProt

P17947

Expression Region

1-270aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-270aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nqo2, Recombinant, Rat, aa1-231, His-SUMO-Tag (Ribosyldihydronicotinamide Dehydrogenase [Quinone])
374463-01 20 µg

Nqo2, Recombinant, Rat, aa1-231, His-SUMO-Tag (Ribosyldihydronicotinamide Dehydrogenase [Quinone])

Sign In for Pricing
View Details
Nqo2, Recombinant, Rat, aa1-231, His-SUMO-Tag (Ribosyldihydronicotinamide Dehydrogenase [Quinone])
374463-02 100 µg

Nqo2, Recombinant, Rat, aa1-231, His-SUMO-Tag (Ribosyldihydronicotinamide Dehydrogenase [Quinone])

Sign In for Pricing
View Details
Six1 (B-8) Alexa Fluor® 647
sc-514441 AF647 200 µg/mL

Six1 (B-8) Alexa Fluor® 647

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum GGI.R1 Protein (aa 1-591)
VAng-Wyb6445-inquire Inquire

Recombinant Plasmodium Falciparum GGI.R1 Protein (aa 1-591)

Sign In for Pricing
View Details
Rat Abcc4 Pre-designed siRNA Set A
SI200050A 1 Each

Rat Abcc4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human CEBPB/CCAAT/enhancer-binding protein beta ELISA Kit
orb1662078 96 Tests

Human CEBPB/CCAAT/enhancer-binding protein beta ELISA Kit

Sign In for Pricing
View Details