Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPI1 protein

This Human SPI1 protein spans the amino acid sequence from region 1-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

31KDA-transforming protein

UniProt

P17947

Expression Region

1-270aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-270aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-AurA (Thr288) Colorimetric Cell-Based ELISA Kit (OKAG01580)
OKAG01580 2x 96 Well

Phospho-AurA (Thr288) Colorimetric Cell-Based ELISA Kit (OKAG01580)

Sign In for Pricing
View Details
Protein Kinase B (PKB) Human ELISA Kit
G3459 96 Tests

Protein Kinase B (PKB) Human ELISA Kit

Sign In for Pricing
View Details
ABCB4 Antibody
GWB-MN930C 50 µg

ABCB4 Antibody

Sign In for Pricing
View Details
EPS8 sgRNA CRISPR Lentivector (Human) (Target 3)
K0689004 1.0 µg DNA

EPS8 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Sheep Tenascin ELISA Kit
OM618223 96 Strip Well

Sheep Tenascin ELISA Kit

Sign In for Pricing
View Details
Lrit2 AAV siRNA Pooled Vector
27599164 1.0 µg

Lrit2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details