Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse LY6G protein

This Mouse LY6G protein spans the amino acid sequence from region 4-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6G.1

UniProt

P35461

Expression Region

4-96aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 4-96aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll-like receptor 6 (TLR6) ELISA Kit
YP-W10224-01 48 Tests

Human Toll-like receptor 6 (TLR6) ELISA Kit

Sign In for Pricing
View Details
Human Toll-like receptor 6 (TLR6) ELISA Kit
YP-W10224-02 96 Tests

Human Toll-like receptor 6 (TLR6) ELISA Kit

Sign In for Pricing
View Details
RAP1AP Protein Lysate (Human) with C-Ha Tag
38495031 100 µg

RAP1AP Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Mkln1 Rat siRNA Oligo Duplex (Locus ID 83536)
SR510391 1 Kit

Mkln1 Rat siRNA Oligo Duplex (Locus ID 83536)

Sign In for Pricing
View Details
IKA C-MAG HS10 Digital Stirrer Package
STI3414 1 Each

IKA C-MAG HS10 Digital Stirrer Package

Sign In for Pricing
View Details
Matrix Metalloproteinase 7, Recombinant, Human (MMP7, Matrilysin, PUMP) discontinued
299450-01 5 µg

Matrix Metalloproteinase 7, Recombinant, Human (MMP7, Matrilysin, PUMP) discontinued

Sign In for Pricing
View Details