Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse LY6G protein

This Mouse LY6G protein spans the amino acid sequence from region 4-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6G.1

UniProt

P35461

Expression Region

4-96aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 4-96aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)
abx346474-01 20 µg

E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)
abx346474-02 50 µg

E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)
abx346474-03 100 µg

E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)
abx346474-04 200 µg

E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)
abx346474-05 1 mg

E3 ubiquitin-protein ligase RNF220 (RNF220) Antibody (HRP)

Sign In for Pricing
View Details
PIK3AP1 Mouse Monoclonal Antibody [Clone 7A12]
E45M10310V-2 50 µL

PIK3AP1 Mouse Monoclonal Antibody [Clone 7A12]

Sign In for Pricing
View Details