Mouse SLC7A10 protein
This Mouse SLC7A10 protein spans the amino acid sequence from region 475-530aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
D-serine transporter Solute carrier family 7 member 10
UniProt
P63115
Expression Region
475-530aa
Tag
N-terminal 6xHis-sumostar-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 475-530aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1163984-01 0.02 mg (E-Coli)
Recombinant Clostridium cellulolyticum ATP synthase subunit beta (atpD)
Sign In for Pricing
View Details MBS1163984-02 0.02 mg (Yeast)
Recombinant Clostridium cellulolyticum ATP synthase subunit beta (atpD)
Sign In for Pricing
View Details MBS1163984-03 0.1 mg (E-Coli)
Recombinant Clostridium cellulolyticum ATP synthase subunit beta (atpD)
Sign In for Pricing
View Details MBS1163984-04 0.1 mg (Yeast)
Recombinant Clostridium cellulolyticum ATP synthase subunit beta (atpD)
Sign In for Pricing
View Details MBS1163984-05 0.02 mg (Baculovirus)
Recombinant Clostridium cellulolyticum ATP synthase subunit beta (atpD)
Sign In for Pricing
View Details MBS1163984-06 0.02 mg (Mammalian-Cell)
Recombinant Clostridium cellulolyticum ATP synthase subunit beta (atpD)
Sign In for Pricing
View Details