Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial XYLE protein

This Bacterial XYLE protein spans the amino acid sequence from region 1-307aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CatO2ase Catechol 2,3-dioxygenase

UniProt

P06622

Expression Region

1-307aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-307aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Rb (Ser780) Rabbit mAb, 1 pack = 50 µL
BAL1774 1 Each

Phospho-Rb (Ser780) Rabbit mAb, 1 pack = 50 µL

Sign In for Pricing
View Details
omniPAGE WAVE Maxi - Casting Stand without base
VS20WAVE-EC 1 Unit

omniPAGE WAVE Maxi - Casting Stand without base

Sign In for Pricing
View Details
ACADL Protein Vector (Human) (pPB-His-MBP)
PV319086 500 ng

ACADL Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Human Acid Phosphatase,ACP ELISA Kit
CN-04515H1 96T

Human Acid Phosphatase,ACP ELISA Kit

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Thiazole synthase (thiG)
MBS1111927-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Thiazole synthase (thiG)
MBS1111927-02 0.02 mg (Yeast)

Recombinant Pseudomonas putida Thiazole synthase (thiG)

Sign In for Pricing
View Details