Bacterial XYLE protein
This Bacterial XYLE protein spans the amino acid sequence from region 1-307aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CatO2ase Catechol 2,3-dioxygenase
UniProt
P06622
Expression Region
1-307aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Pseudomonas putida (Arthrobacter siderocapsulatus)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
55.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-307aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6276719-01 0.1 mL
ATP6V1G1, CT (ATP6V1G1, ATP6G, ATP6G1, ATP6J, V-type proton ATPase subunit G 1, V-ATPase 13kD subunit 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16) (MaxLight 650)
Sign In for Pricing
View Details MBS6276719-02 5x 0.1 mL
ATP6V1G1, CT (ATP6V1G1, ATP6G, ATP6G1, ATP6J, V-type proton ATPase subunit G 1, V-ATPase 13kD subunit 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16) (MaxLight 650)
Sign In for Pricing
View Details G8600-06F 50 µg
G-Protein Coupled Receptor 3 (GPCR3, GPR3) discontinued
Sign In for Pricing
View Details