Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OXT protein

This Human OXT protein spans the amino acid sequence from region 32-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ocytocin

UniProt

P01178

Expression Region

32-125aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 32-125aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASF1A Antibody - C-terminal region : FITC (ARP74397_P050-FITC)
ARP74397_P050-FITC 100 µL

ASF1A Antibody - C-terminal region : FITC (ARP74397_P050-FITC)

Sign In for Pricing
View Details
FLJ11506 CRISPR Activation Plasmid (h2)
sc-413223-ACT-2 20 µg

FLJ11506 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
KLRC1 Protein Vector (Human) (pPM-C-His)
PV023032 500 ng

KLRC1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
EPG5 Polyclonal Antibody
orb1415767 100 µL

EPG5 Polyclonal Antibody

Sign In for Pricing
View Details
TKTL2 siRNA (Mouse)
CRM9249-01 15 nmol

TKTL2 siRNA (Mouse)

Sign In for Pricing
View Details
TKTL2 siRNA (Mouse)
CRM9249-02 30 nmol

TKTL2 siRNA (Mouse)

Sign In for Pricing
View Details