Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OXT protein

This Human OXT protein spans the amino acid sequence from region 32-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ocytocin

UniProt

P01178

Expression Region

32-125aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 32-125aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN5 sgRNA CRISPR Lentivector (Human) (Target 3)
K2678204 1.0 µg DNA

ZKSCAN5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
2- (2-Oxopyrrolidin-3-yl) acetic acid
ECA72973-01 50 mg

2- (2-Oxopyrrolidin-3-yl) acetic acid

Sign In for Pricing
View Details
2- (2-Oxopyrrolidin-3-yl) acetic acid
ECA72973-02 0.5 g

2- (2-Oxopyrrolidin-3-yl) acetic acid

Sign In for Pricing
View Details
Rabbit Polyclonal KRT78 Antibody [Allophycocyanin]
NBP3-06028APC 0.1 mL

Rabbit Polyclonal KRT78 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit Anti-ZNF664 antibody
SL16526R-01 50 µL

Rabbit Anti-ZNF664 antibody

Sign In for Pricing
View Details
Rabbit Anti-ZNF664 antibody
SL16526R-02 100 µL

Rabbit Anti-ZNF664 antibody

Sign In for Pricing
View Details