Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey APOC3 protein

This Monkey APOC3 protein spans the amino acid sequence from region 21-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein C3

UniProt

P18659

Expression Region

21-99aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 21-99aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)
MBS2060359-01 0.1 mL

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)
MBS2060359-02 0.2 mL

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)
MBS2060359-03 0.5 mL

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)
MBS2060359-04 1 mL

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)
MBS2060359-05 5 mL

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)
MBS2060359-06 5x 5 mL

APC-Linked Polyclonal Antibody to Salusin Alpha (SALa)

Sign In for Pricing
View Details