Monkey APOC3 protein
This Monkey APOC3 protein spans the amino acid sequence from region 21-99aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Apolipoprotein C3
UniProt
P18659
Expression Region
21-99aa
Tag
N-terminal 6xHis-sumostar-tagged
Source
Yeast
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 21-99aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2904001-01 20 µg
Recombinant Xenopus laevis Transmembrane protein 39B (tmem39b)
Sign In for Pricing
View Details orb2904001-02 100 µg
Recombinant Xenopus laevis Transmembrane protein 39B (tmem39b)
Sign In for Pricing
View Details 
MBS2026558-01 0.1 mL
Polyclonal Antibody to Syntaxin 1A, Brain (STX1A)
Sign In for Pricing
View Details MBS2026558-02 0.2 mL
Polyclonal Antibody to Syntaxin 1A, Brain (STX1A)
Sign In for Pricing
View Details MBS2026558-03 0.5 mL
Polyclonal Antibody to Syntaxin 1A, Brain (STX1A)
Sign In for Pricing
View Details MBS2026558-04 1 mL
Polyclonal Antibody to Syntaxin 1A, Brain (STX1A)
Sign In for Pricing
View Details