Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCNB1 protein

This Human CCNB1 protein spans the amino acid sequence from region 1-433aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCNB

UniProt

P14635

Expression Region

1-433aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-433aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAS2 Blocking Peptide
MBS9628860-01 1 mg

RRAS2 Blocking Peptide

Sign In for Pricing
View Details
RRAS2 Blocking Peptide
MBS9628860-02 5x 1 mg

RRAS2 Blocking Peptide

Sign In for Pricing
View Details
PEA-15 discontinued
540877-01 30ul

PEA-15 discontinued

Sign In for Pricing
View Details
PEA-15 discontinued
540877-02 100 µL

PEA-15 discontinued

Sign In for Pricing
View Details
Sameridine hydrochloride
orb2565330-01 10 mg

Sameridine hydrochloride

Sign In for Pricing
View Details
Sameridine hydrochloride
orb2565330-02 50 mg

Sameridine hydrochloride

Sign In for Pricing
View Details