Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit ITGB8 protein

This Rabbit ITGB8 protein spans the amino acid sequence from region 146-384aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITGB8Integrin beta-8

UniProt

P26013

Expression Region

146-384aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 146-384aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1), partial
orb2659564-01 20 µg

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1), partial

Sign In for Pricing
View Details
Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1), partial
orb2659564-02 100 µg

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1), partial

Sign In for Pricing
View Details
Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1), partial
orb2659564-03 1 mg

Recombinant Human Transmembrane 9 superfamily member 1 (TM9SF1), partial

Sign In for Pricing
View Details
Complement Component 4c
546156 200 µL

Complement Component 4c

Sign In for Pricing
View Details
DNAJC10 Rabbit Polyclonal Antibody (HRP)
orb2603701 100 µg

DNAJC10 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
KD-Validated Anti-Crystallin alpha B Rabbit Monoclonal Antibody
AGI1056-100 100 µL

KD-Validated Anti-Crystallin alpha B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details