Rabbit ITGB8 protein
This Rabbit ITGB8 protein spans the amino acid sequence from region 146-384aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ITGB8Integrin beta-8
UniProt
P26013
Expression Region
146-384aa
Tag
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Source
Yeast
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 146-384aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
041746-ML490 100 µL
SILV, ID (PMEL, D12S53E, PMEL17, SILV, Melanocyte protein PMEL, ME20-M, Melanocyte protein Pmel 17, Melanocytes lineage-specific antigen GP100, Melanoma-associated ME20 antigen, P1, P100, Premelanosome protein, Silver locus protein homolog, M-alpha, 95kD melanocyte-specific secreted glycoprotein, P26, Secreted melanoma-associated ME20 antigen, M-beta) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
AK0588-50T-24S 50 Tests - 24 Samples
Soil Cellulase (S-CL) Activity Assay Kit
Sign In for Pricing
View Details 