Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HSPX protein

This Bacterial HSPX protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

16KDA antigen HSP 16.3

UniProt

P0A5B8

Expression Region

2-144aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-144aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human P2RY4 Knockout HEK293T cell line
GTR15412162 1 Vial

Human P2RY4 Knockout HEK293T cell line

Sign In for Pricing
View Details
c-Fos Antibody, Clone 5B10: HRP
MBS809181-01 0.1 mg

c-Fos Antibody, Clone 5B10: HRP

Sign In for Pricing
View Details
c-Fos Antibody, Clone 5B10: HRP
MBS809181-02 5x 0.1 mg

c-Fos Antibody, Clone 5B10: HRP

Sign In for Pricing
View Details
C13ORF8 Rabbit Polyclonal Antibody
orb324392 100 µL

C13ORF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4,5-Diepipsidial A
TN3011 5 mg

4,5-Diepipsidial A

Sign In for Pricing
View Details
Human NUP107 (Nucleoporin 107kDa) ELISA Kit
MBS2501841-01 24 Tests

Human NUP107 (Nucleoporin 107kDa) ELISA Kit

Sign In for Pricing
View Details