Bacterial HSPX protein
This Bacterial HSPX protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
16KDA antigen HSP 16.3
UniProt
P0A5B8
Expression Region
2-144aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 2-144aaSequence Info: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6391453-01 0.1 mL
PTPRN2 (Protein Tyrosine Phosphatase IA-2 Beta, Receptor-type Tyrosine-protein Phosphatase N2, R-PTP-N2, Islet Cell Autoantigen-related Protein, IAR, ICAAR, Phogrin, KIAA0387) (Biotin)
Sign In for Pricing
View Details MBS6391453-02 5x 0.1 mL
PTPRN2 (Protein Tyrosine Phosphatase IA-2 Beta, Receptor-type Tyrosine-protein Phosphatase N2, R-PTP-N2, Islet Cell Autoantigen-related Protein, IAR, ICAAR, Phogrin, KIAA0387) (Biotin)
Sign In for Pricing
View Details 
HCA030U046X25065A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE
C8 HPLC Column,4.6 x 250mm,3μm
Sign In for Pricing
View Details