Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit Apolipoprotein E protein

This Rabbit Apolipoprotein E protein spans the amino acid sequence from region 20-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

APOEApolipoprotein E, Apo-E

UniProt

P18287

Expression Region

20-311aa

Tag

N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-taggedExpression Region: 20-311aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor VIII B chain Antibody HRP Conjugated
MBS9460241-01 0.1 mL

Factor VIII B chain Antibody HRP Conjugated

Sign In for Pricing
View Details
Factor VIII B chain Antibody HRP Conjugated
MBS9460241-02 5x 0.1 mL

Factor VIII B chain Antibody HRP Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human Shd Polyclonal Antibody
PA90194HU-01 50 µg

Rabbit Anti-Human Shd Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Shd Polyclonal Antibody
PA90194HU-02 100 µg

Rabbit Anti-Human Shd Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Shd Polyclonal Antibody
PA90194HU-03 500 µg

Rabbit Anti-Human Shd Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Shd Polyclonal Antibody
PA90194HU-04 1 mg

Rabbit Anti-Human Shd Polyclonal Antibody

Sign In for Pricing
View Details