Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat GLP1R protein

This Rat GLP1R protein spans the amino acid sequence from region 22-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glp1r, GlprGlucagon-like peptide 1 receptor, GLP-1 receptor, GLP-1-R, GLP-1R

UniProt

P32301

Expression Region

22-135aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-135aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grainyhead like protein 1 homolog (GRHL1) (NM_014552) Human Recombinant Protein
TP309683 20 µg

Grainyhead like protein 1 homolog (GRHL1) (NM_014552) Human Recombinant Protein

Sign In for Pricing
View Details
Lawesson’s Reagent
TRC-L178780-10G 10 g

Lawesson’s Reagent

Sign In for Pricing
View Details
S-[2-Hydroxy-2-(4-hydroxyphenyl)ethyl]-L-glutathione (>90%)
TRC-H943185-5MG 5 mg

S-[2-Hydroxy-2-(4-hydroxyphenyl)ethyl]-L-glutathione (>90%)

Sign In for Pricing
View Details
Prl7c1 Mouse Gene Knockout Kit (CRISPR)
KN513920 1 Kit

Prl7c1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), Biotin conjugate, 0.1mg/mL
BNCB1810-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Canine VEGF (Vascular Endothelial Cell Growth Factor) ELISA Kit
E-UNEL-C0003-01 5x 96 Tests

Uncoated Canine VEGF (Vascular Endothelial Cell Growth Factor) ELISA Kit

Sign In for Pricing
View Details