Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat GLP1R protein

This Rat GLP1R protein spans the amino acid sequence from region 22-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glp1r, GlprGlucagon-like peptide 1 receptor, GLP-1 receptor, GLP-1-R, GLP-1R

UniProt

P32301

Expression Region

22-135aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-135aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tslrn1 activation kit by CRISPRa
GA210255 1 Kit

Mouse Tslrn1 activation kit by CRISPRa

Sign In for Pricing
View Details
TNFRSF4 Mouse Monoclonal Antibody [Clone ID: OTI7H9]
CF812430 100 µg

TNFRSF4 Mouse Monoclonal Antibody [Clone ID: OTI7H9]

Sign In for Pricing
View Details
Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH09-09]
HA721690 100 µL

Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH09-09]

Sign In for Pricing
View Details
RPL3 (NM_000967) Human Over-expression Lysate
LY424411 100 µg

RPL3 (NM_000967) Human Over-expression Lysate

Sign In for Pricing
View Details
ARSA (NM_001085425) Human Over-expression Lysate
LY425979 100 µg

ARSA (NM_001085425) Human Over-expression Lysate

Sign In for Pricing
View Details
DNASE1L2 Rabbit Polyclonal Antibody
TA368066 100 µL

DNASE1L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details