Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat GLP1R protein

This Rat GLP1R protein spans the amino acid sequence from region 22-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glp1r, GlprGlucagon-like peptide 1 receptor, GLP-1 receptor, GLP-1-R, GLP-1R

UniProt

P32301

Expression Region

22-135aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-135aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Isoleucine-13C6, 15N
TRC-I824088-5MG 5 mg

L-Isoleucine-13C6, 15N

Sign In for Pricing
View Details
EverBrite TrueBlack® Hardset Mounting Medium
#23017 1x 10 mL

EverBrite TrueBlack® Hardset Mounting Medium

Sign In for Pricing
View Details
OFD1 Human Gene Knockout Kit (CRISPR)
KN420154 1 Kit

OFD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ac-lys(ac)-OH
TRC-A169240-1G 1 g

Ac-lys(ac)-OH

Sign In for Pricing
View Details
EGR4 Rabbit Polyclonal Antibody
HA500445 100 µL

EGR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLUAP1 Human Gene Knockout Kit (CRISPR)
KN402262 1 Kit

CLUAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details