Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGFP protein

This Human EGFP protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

C5MKY7

Expression Region

1-239aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Human cytomegalovirus (HHV-5) (Human herpesvirus 5)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-239aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV639910 1.0 µg DNA

NSUN7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Fiber Glass Tape Measures
2010880/4A 1 Each

Fiber Glass Tape Measures

Sign In for Pricing
View Details
Cholecystokinin (CCK) Monoclonal Antibody
CAU34990-01 100 µL

Cholecystokinin (CCK) Monoclonal Antibody

Sign In for Pricing
View Details
Cholecystokinin (CCK) Monoclonal Antibody
CAU34990-02 200 µL

Cholecystokinin (CCK) Monoclonal Antibody

Sign In for Pricing
View Details
Cholecystokinin (CCK) Monoclonal Antibody
CAU34990-03 1 mL

Cholecystokinin (CCK) Monoclonal Antibody

Sign In for Pricing
View Details
APOL4 Antibody
GWB-MW164B 50 µg

APOL4 Antibody

Sign In for Pricing
View Details