Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGFP protein

This Human EGFP protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

C5MKY7

Expression Region

1-239aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Human cytomegalovirus (HHV-5) (Human herpesvirus 5)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-239aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle
RC221382L1V 200 µL

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ctag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3201006 1.0 µg DNA

Ctag2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica fliV Protein (aa 1-89)
VAng-Cr1872-50gEcoli 50 µg (E. coli)

Recombinant Yersinia Enterocolitica fliV Protein (aa 1-89)

Sign In for Pricing
View Details
Olfactory receptor 52W1 rabbit pAb Antibody
orb765934-01 50 μL

Olfactory receptor 52W1 rabbit pAb Antibody

Sign In for Pricing
View Details
Olfactory receptor 52W1 rabbit pAb Antibody
orb765934-02 100 µL

Olfactory receptor 52W1 rabbit pAb Antibody

Sign In for Pricing
View Details
Human SLAMF5 (Signaling Lymphocytic Activation Molecule Family, Member 5) Microsample ELISA Kit
ELK8729MS-01 48 Tests

Human SLAMF5 (Signaling Lymphocytic Activation Molecule Family, Member 5) Microsample ELISA Kit

Sign In for Pricing
View Details