Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial GELE protein

This Bacterial GELE protein spans the amino acid sequence from region 193-510aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coccolysin

UniProt

Q833V7

Expression Region

193-510aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 193-510aaSequence Info: Full Length of Isoform 3

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASVVSAAFNSAGIGAKEDIQVNQPSESVLVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MDL-1/CLEC5A Antibody (283834) [Janelia Fluor 525]
FAB2384JF525 0.1 mL

Mouse Monoclonal MDL-1/CLEC5A Antibody (283834) [Janelia Fluor 525]

Sign In for Pricing
View Details
Mouse Monoclonal Monkeypox Virus E8L Antibody (14) [DyLight 680]
NBP3-30751FR 0.1 mL

Mouse Monoclonal Monkeypox Virus E8L Antibody (14) [DyLight 680]

Sign In for Pricing
View Details
Rabbit Anti-Human ATP1A2 pAb
PA7412-01 50 μL

Rabbit Anti-Human ATP1A2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ATP1A2 pAb
PA7412-02 100 μL

Rabbit Anti-Human ATP1A2 pAb

Sign In for Pricing
View Details
gp91phox CRISPR Activation Plasmid (m2)
sc-419890-ACT-2 20 µg

gp91phox CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
CSNK1A1L Antibody Blocking peptide
orb1445748 500 µg

CSNK1A1L Antibody Blocking peptide

Sign In for Pricing
View Details