Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial GELE protein

This Bacterial GELE protein spans the amino acid sequence from region 193-510aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coccolysin

UniProt

Q833V7

Expression Region

193-510aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 193-510aaSequence Info: Full Length of Isoform 3

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASVVSAAFNSAGIGAKEDIQVNQPSESVLVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A32 ORF Vector (Human) (pORF)
44016011 1.0 µg DNA

SLC25A32 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SPHAR rabbit pAb
ES12991-01 50 µL

SPHAR rabbit pAb

Sign In for Pricing
View Details
SPHAR rabbit pAb
ES12991-02 100 µL

SPHAR rabbit pAb

Sign In for Pricing
View Details
KIAA1549 (NM_001164665) Human Tagged ORF Clone
RC228703 10 µg

KIAA1549 (NM_001164665) Human Tagged ORF Clone

Sign In for Pricing
View Details
BCLX Mouse Monoclonal Antibody
E38QA9377 100 µL

BCLX Mouse Monoclonal Antibody

Sign In for Pricing
View Details
FAM115A CRISPR All-in-one AAV vector set (with saCas9)(Human)
19722151 3x 1.0 µg DNA

FAM115A CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details