Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial GELE protein

This Bacterial GELE protein spans the amino acid sequence from region 193-510aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coccolysin

UniProt

Q833V7

Expression Region

193-510aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 193-510aaSequence Info: Full Length of Isoform 3

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASVVSAAFNSAGIGAKEDIQVNQPSESVLVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque SEC63 Protein, His (Fc)-Avi-tagged
SEC63-3947R 50 µg

Recombinant Rhesus Macaque SEC63 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Custom Peptide Synthesis, Modification, Cysteine (ACM)
CS080-038 Per Peptide

Custom Peptide Synthesis, Modification, Cysteine (ACM)

Sign In for Pricing
View Details
Recombinant Rat Glia Maturation Factor Beta
7-00617 10 µg

Recombinant Rat Glia Maturation Factor Beta

Sign In for Pricing
View Details
Lentiviral mouse Retreg2 shRNA (UAS) - Lentiviral mouse Retreg2 shRNA (UAS, RFP) (25)
GTR15238511 1 Vial

Lentiviral mouse Retreg2 shRNA (UAS) - Lentiviral mouse Retreg2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Monkey Dystrophin ELISA Kit
MBS038662-01 48 Well

Monkey Dystrophin ELISA Kit

Sign In for Pricing
View Details
Monkey Dystrophin ELISA Kit
MBS038662-02 96 Well

Monkey Dystrophin ELISA Kit

Sign In for Pricing
View Details