Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CD63 protein

This Mouse CD63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD63

UniProt

P41731

Expression Region

103-203aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 103-203aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42 (NM_044472) Human Tagged Lenti ORF Clone
RC216559L2 10 µg

CDC42 (NM_044472) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sheep Dynamin 2 (DNM2) ELISA Kit
abx364096 96 Well

Sheep Dynamin 2 (DNM2) ELISA Kit

Sign In for Pricing
View Details
CDKAL1 (NM_017774) Human Recombinant Protein
TP324917 20 µg

CDKAL1 (NM_017774) Human Recombinant Protein

Sign In for Pricing
View Details
TFIIE-α (h) -PR
sc-36651-PR 10 µM - 20 µL

TFIIE-α (h) -PR

Sign In for Pricing
View Details
Rabbit Polyclonal Serpin A7/TBG Antibody [DyLight 680]
NBP2-99678FR 0.1 mL

Rabbit Polyclonal Serpin A7/TBG Antibody [DyLight 680]

Sign In for Pricing
View Details
ZNF420
582242-01 50 µL

ZNF420

Sign In for Pricing
View Details