Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CD63 protein

This Mouse CD63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD63

UniProt

P41731

Expression Region

103-203aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 103-203aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SSB (Lupus La protein) ELISA Kit
EM2224 96 Tests

Mouse SSB (Lupus La protein) ELISA Kit

Sign In for Pricing
View Details
SULF1 Protein Lysate (Mouse) with C-HA Tag
45836035 100 µg

SULF1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
W/M/W014/M008/FR220-PP-450x300/1-B Safety & Regulatory Compliance Signs (No Adhesive)
139079 1 Pack (1 Panel (s) x 1 Pack)

W/M/W014/M008/FR220-PP-450x300/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
Astn2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4896402 1.0 µg DNA

Astn2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Sheep Olfactory receptor 2K2 (OR2K2) ELISA kit
GTR10392213 96 Well

Sheep Olfactory receptor 2K2 (OR2K2) ELISA kit

Sign In for Pricing
View Details
Mouse Herc2 activation kit by CRISPRa
GA201875 1 Kit

Mouse Herc2 activation kit by CRISPRa

Sign In for Pricing
View Details