Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CD63 protein

This Mouse CD63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD63

UniProt

P41731

Expression Region

103-203aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 103-203aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf88 (NM_001042520) Human Tagged Lenti ORF Clone
RC213362L4 10 µg

C2orf88 (NM_001042520) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Galanin (B-8) P
sc-166927 P 100 µg - 0.5 mL

Galanin (B-8) P

Sign In for Pricing
View Details
Gracillin
sc-490332 5 mg

Gracillin

Sign In for Pricing
View Details
KIR2DS3 (Killer Cell Immunoglobulin-like Receptor 2DS3, MHC Class I NK Cell Receptor, Natural Killer-associated Transcript 7, NKAT-7, NKAT7) (Biotin)
MBS6383610-01 0.1 mL

KIR2DS3 (Killer Cell Immunoglobulin-like Receptor 2DS3, MHC Class I NK Cell Receptor, Natural Killer-associated Transcript 7, NKAT-7, NKAT7) (Biotin)

Sign In for Pricing
View Details
KIR2DS3 (Killer Cell Immunoglobulin-like Receptor 2DS3, MHC Class I NK Cell Receptor, Natural Killer-associated Transcript 7, NKAT-7, NKAT7) (Biotin)
MBS6383610-02 5x 0.1 mL

KIR2DS3 (Killer Cell Immunoglobulin-like Receptor 2DS3, MHC Class I NK Cell Receptor, Natural Killer-associated Transcript 7, NKAT-7, NKAT7) (Biotin)

Sign In for Pricing
View Details
MHC Class 1 (MHC Class I) (MaxLight 750)
MBS6257201-01 0.1 mL

MHC Class 1 (MHC Class I) (MaxLight 750)

Sign In for Pricing
View Details