Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Small delta antigen protein

This Viral Small delta antigen protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P24

UniProt

P06934

Expression Region

1-195aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-195aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF434 (ZSCAN32) (NM_001284527) Human Tagged ORF Clone
RG239337 10 µg

ZNF434 (ZSCAN32) (NM_001284527) Human Tagged ORF Clone

Sign In for Pricing
View Details
EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI6F7]
CF808539 100 µg

EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI6F7]

Sign In for Pricing
View Details
Immobilized Allium sativum Lectin (Garlic) -ASA
A-8007-1 1 mL

Immobilized Allium sativum Lectin (Garlic) -ASA

Sign In for Pricing
View Details
Rust Prevention Tester BPTL-208
BPTL-208 1 Unit

Rust Prevention Tester BPTL-208

Sign In for Pricing
View Details
Human SKOR1 activation kit by CRISPRa
GA118167 1 Kit

Human SKOR1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF568 conjugate, 0.1mg/mL
BNC682670-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details