Viral Small delta antigen protein
This Viral Small delta antigen protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
P24
UniProt
P06934
Expression Region
1-195aa
Tag
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Source
Yeast
Origin
Hepatitis delta virus genotype I (isolate Italian) (HDV)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-195aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP721387M 100 µg
SSTR2 Human Recombinant Protein, Synthetic Nanodisc
Sign In for Pricing
View Details 
![FH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]](https://cdn.genprice.uk/products/937/6868c319994c49e6dc3eed2f/imageurl/ta500675bm.webp)
TA500675BM 100 µL
FH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F10]
Sign In for Pricing
View Details ![MSF (SEPT9) Mouse Monoclonal Antibody [Clone ID: OTI2B12]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908e26/imageurl/cf812819.webp)
CF812819 100 µg
MSF (SEPT9) Mouse Monoclonal Antibody [Clone ID: OTI2B12]
Sign In for Pricing
View Details 
HP221024 200 Reactions
LINC01118 Human qPCR Primer Pair (XM_087019)
Sign In for Pricing
View Details