Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Small delta antigen protein

This Viral Small delta antigen protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P24

UniProt

P06934

Expression Region

1-195aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-195aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloro(triethylphosphine)gold
TRC-C552990-1G 1 g

Chloro(triethylphosphine)gold

Sign In for Pricing
View Details
MycoLight™ PMA [Propidium Monoazide] *5 mM Water Solution*
24216-AAT 100 µL

MycoLight™ PMA [Propidium Monoazide] *5 mM Water Solution*

Sign In for Pricing
View Details
FAM124B (NM_024785) Human Over-expression Lysate
LY403030 100 µg

FAM124B (NM_024785) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant beta-2-Microglobulin Antibody
RC-4309-01 50 μL

Recombinant beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Recombinant beta-2-Microglobulin Antibody
RC-4309-02 100 µL

Recombinant beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Recombinant beta-2-Microglobulin Antibody
RC-4309-03 1 mL

Recombinant beta-2-Microglobulin Antibody

Sign In for Pricing
View Details