Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL7 protein

This Human IL7 protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL 7, IL-7, Il7, IL7_HUMAN, Interleukin 7, Interleukin-7, LP-1, Lymphopoietin 1

UniProt

P13232

Expression Region

26-177aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged24-246AA: 26-177AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PARP16 shRNA (UAS) - Lentiviral human PARP16 shRNA (UAS, GFP) (100)
GTR15133881 1 Vial

Lentiviral human PARP16 shRNA (UAS) - Lentiviral human PARP16 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ZWINT Antibody
MBS9629120-01 0.1 mL

ZWINT Antibody

Sign In for Pricing
View Details
ZWINT Antibody
MBS9629120-02 0.2 mL

ZWINT Antibody

Sign In for Pricing
View Details
ZWINT Antibody
MBS9629120-03 5x 0.2 mL

ZWINT Antibody

Sign In for Pricing
View Details
8- (Tosylamino) quinoline
sc-227125 5 g

8- (Tosylamino) quinoline

Sign In for Pricing
View Details
BEND2 Polyclonal Antibody, PE Conjugated
bs-9551R-PE 100 µL

BEND2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details