Human FHL3 protein
This Human FHL3 protein spans the amino acid sequence from region 1-280aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Skeletal muscle LIM-protein 2
UniProt
Q13643
Expression Region
1-280aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Disease Biomarkers
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
58.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-244AA: 1-280AAFull Length of Isoform 2 : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 647 Anti-Mouse CD103 Antibody[M290]](https://cdn.genprice.uk/products/763/68dd14a4061270361e7d128b/imageurl/e-ab-f1090m.webp)
E-AB-F1090M-01 50 Tests
Elab Fluor® 647 Anti-Mouse CD103 Antibody[M290]
Sign In for Pricing
View Details E-AB-F1090M-02 100 Tests
Elab Fluor® 647 Anti-Mouse CD103 Antibody[M290]
Sign In for Pricing
View Details E-AB-F1090M-03 2x 100 Tests
Elab Fluor® 647 Anti-Mouse CD103 Antibody[M290]
Sign In for Pricing
View Details 
BNC473092-100 1x 100 µL
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC883284-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3284), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details