Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FHL3 protein

This Human FHL3 protein spans the amino acid sequence from region 1-280aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Skeletal muscle LIM-protein 2

UniProt

Q13643

Expression Region

1-280aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-244AA: 1-280AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 (Endoglin) discontinued
144304 100 µg

CD105 (Endoglin) discontinued

Sign In for Pricing
View Details
MARVELD2 Rabbit Polyclonal Antibody (Fluoro488)
orb3103143 100 µg

MARVELD2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
SDHD Antibody (N-term)
orb1937705-01 50 µL

SDHD Antibody (N-term)

Sign In for Pricing
View Details
SDHD Antibody (N-term)
orb1937705-02 100 µL

SDHD Antibody (N-term)

Sign In for Pricing
View Details
2,4-Bis (trifluoromethyl) benzoic acid
FB82828-01 10 g

2,4-Bis (trifluoromethyl) benzoic acid

Sign In for Pricing
View Details
2,4-Bis (trifluoromethyl) benzoic acid
FB82828-02 25 g

2,4-Bis (trifluoromethyl) benzoic acid

Sign In for Pricing
View Details