Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MYL7 protein

This Human MYL7 protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin regulatory light chain 7

UniProt

Q01449

Expression Region

1-175aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-297AA: 1-175AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD40 (Rabbit, Monoclonal)
A100961 100 µL

Anti-CD40 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Rabbit Polyclonal C21orf62 Antibody
NBP1-80554 100 µL

Rabbit Polyclonal C21orf62 Antibody

Sign In for Pricing
View Details
Cadm1 ORF Vector (Mouse) (pORF)
14909015 1.0 µg DNA

Cadm1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FSH mAb1
MBS478059-01 1 mg

FSH mAb1

Sign In for Pricing
View Details
FSH mAb1
MBS478059-02 2 mg

FSH mAb1

Sign In for Pricing
View Details
FSH mAb1
MBS478059-03 5 mg

FSH mAb1

Sign In for Pricing
View Details