Human TIMM17B protein
This Human TIMM17B protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
DXS9822, Inner mitochondrial membrane preprotein translocase, JM3, Mitochondrial import inner membrane translocase subunit Tim17-B, TI17B_HUMAN, Tim17b, TIMM17B, Translocase of inner mitochondrial membrane 17 homolog B (yeast)
UniProt
O60830
Expression Region
1-172aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
45.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-150AA: 1-172AAFull Length of Isoform MLC3: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
JL12063-01 48 Tests
Human Mannose Binding Lectin (MBP; MBL) ELISA Kit
Sign In for Pricing
View Details JL12063-02 96 Tests
Human Mannose Binding Lectin (MBP; MBL) ELISA Kit
Sign In for Pricing
View Details 
CFPPP0065M100AG1PSS0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE
Pleated Cartridge, Polypro,0.65μm, M.layer Fil,10", OD:69mm,226/Fin, Polypro, Silicone, Standard, Rev.0
Sign In for Pricing
View Details 
036763 200 µL
HRH2, ID (HRH2, Histamine H2 receptor, Gastric receptor I)
Sign In for Pricing
View Details MBS2091437-01 0.1 mL
Biotin-Linked Polyclonal Antibody to Interleukin 15 (IL15)
Sign In for Pricing
View Details MBS2091437-02 0.2 mL
Biotin-Linked Polyclonal Antibody to Interleukin 15 (IL15)
Sign In for Pricing
View Details