Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EEF1B2 protein

This Human EEF1B2 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EEF1B, EEF1B1, EEF1B2, EF-1-beta, EF1B, EF1B_HUMAN, Elongation factor 1, beta-2-A, Elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2

UniProt

P24534

Expression Region

1-225aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-Trx-tagged: N-terminal GST-tagged1-100AA: 1-225AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSD-93 siRNA (h)
sc-36321 10 µM

PSD-93 siRNA (h)

Sign In for Pricing
View Details
COL4A6 Rabbit Polyclonal Antibody
APRab09190-01 20 µL

COL4A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL4A6 Rabbit Polyclonal Antibody
APRab09190-02 50 µL

COL4A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL4A6 Rabbit Polyclonal Antibody
APRab09190-03 100 µL

COL4A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COL4A6 Rabbit Polyclonal Antibody
APRab09190-04 200 µL

COL4A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal Oval Cell Marker Antibody (OC2-2A6) [Alexa Fluor 750]
NBP1-18967AF750 0.1 mL

Rat Monoclonal Oval Cell Marker Antibody (OC2-2A6) [Alexa Fluor 750]

Sign In for Pricing
View Details