What is the catalog number for Human EEF1B2 protein?

The catalog number for Human EEF1B2 protein is orb54499.

What sizes are available for Human EEF1B2 protein?

Human EEF1B2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human EEF1B2 protein come in?

Human EEF1B2 protein is available in 3 different pack sizes.

Is Human EEF1B2 protein in stock?

Human EEF1B2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human EEF1B2 protein

This Human EEF1B2 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EEF1B, EEF1B1, EEF1B2, EF-1-beta, EF1B, EF1B_HUMAN, Elongation factor 1, beta-2-A, Elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2

UniProt

P24534

Expression Region

1-225aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-Trx-tagged: N-terminal GST-tagged1-100AA: 1-225AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI