Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EEF1B2 protein

This Human EEF1B2 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EEF1B, EEF1B1, EEF1B2, EF-1-beta, EF1B, EF1B_HUMAN, Elongation factor 1, beta-2-A, Elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2

UniProt

P24534

Expression Region

1-225aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-Trx-tagged: N-terminal GST-tagged1-100AA: 1-225AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vcl (NM_001107248) Rat Untagged Clone
RN203691 10 µg

Vcl (NM_001107248) Rat Untagged Clone

Sign In for Pricing
View Details
GAPT (H-8) Alexa Fluor® 790
sc-398271 AF790 200 µg/mL

GAPT (H-8) Alexa Fluor® 790

Sign In for Pricing
View Details
OR8G1 (h) -PR
sc-96632-PR 10 µM - 20 µL

OR8G1 (h) -PR

Sign In for Pricing
View Details
MEIS1 Antibody
ABD8368 100 µg

MEIS1 Antibody

Sign In for Pricing
View Details
Dectin 1 (CLEC7A) (NM_197954) Human Over-expression Lysate
LC430694 20 µg

Dectin 1 (CLEC7A) (NM_197954) Human Over-expression Lysate

Sign In for Pricing
View Details
BLK, NT (Tyrosine-protein Kinase Blk, B Lymphoid Tyrosine Kinase, p55-Blk) (PE)
MBS6465383-01 0.2 mL

BLK, NT (Tyrosine-protein Kinase Blk, B Lymphoid Tyrosine Kinase, p55-Blk) (PE)

Sign In for Pricing
View Details