Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABARAPL1 protein

This Human GABARAPL1 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Early estrogen-regulated protein GABA (A) receptor-associated protein-like 1 Glandular epithelial cell protein 1

UniProt

Q9H0R8

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-358AA: 1-117AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit
DL-TGFa-Si-01 48 Tests

Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit

Sign In for Pricing
View Details
Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit
DL-TGFa-Si-02 96 Tests

Monkey Transforming Growth Factor Alpha (TGFa) ELISA Kit

Sign In for Pricing
View Details
L- (+) -Cystathionine
C8948-26-01 5 mg

L- (+) -Cystathionine

Sign In for Pricing
View Details
L- (+) -Cystathionine
C8948-26-02 25 mg

L- (+) -Cystathionine

Sign In for Pricing
View Details
L- (+) -Cystathionine
C8948-26-03 50 mg

L- (+) -Cystathionine

Sign In for Pricing
View Details
Fish TBC1 Domain Family Member 9 (TBC1D9) ELISA Kit
MBS9357237 Inquire

Fish TBC1 Domain Family Member 9 (TBC1D9) ELISA Kit

Sign In for Pricing
View Details