Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABARAPL1 protein

This Human GABARAPL1 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Early estrogen-regulated protein GABA (A) receptor-associated protein-like 1 Glandular epithelial cell protein 1

UniProt

Q9H0R8

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-358AA: 1-117AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphostin
TN10001-01 10 mg

Lymphostin

Sign In for Pricing
View Details
Lymphostin
TN10001-02 50 mg

Lymphostin

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS600003 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K (VCA) beta-4, Maxi K Channel Subunit beta-4, Slo-beta-4) (PE)
128754-PE 100 µL

KCNMB4 (Calcium-activated Potassium Channel Subunit beta-4, BK Channel Subunit beta-4, BKbeta4, Hbeta4, Calcium-activated Potassium Channel, Subfamily M Subunit beta-4, Charybdotoxin Receptor Subunit beta-4, K (VCA) beta-4, Maxi K Channel Subunit beta-4, Slo-beta-4) (PE)

Sign In for Pricing
View Details
Recombinant Human CD141/THBD Protein, N-His
E55P6991 50 µg

Recombinant Human CD141/THBD Protein, N-His

Sign In for Pricing
View Details
Recombinant Clostridium Tetani eutC Protein (aa 1-294)
VAng-Lsx01609-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Tetani eutC Protein (aa 1-294)

Sign In for Pricing
View Details