Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LELP1 protein

This Human LELP1 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Novel small proline-rich protein

UniProt

Q5T871

Expression Region

1-98aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-176AA: 1-98AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow Molybdenum cofactor sulfurase (MOCOS) ELISA Kit
abx516487 96 Tests

Cow Molybdenum cofactor sulfurase (MOCOS) ELISA Kit

Sign In for Pricing
View Details
CHRNA10 Rabbit Polyclonal Antibody
TA359379 100 µL

CHRNA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IgG4 Fc (224AA)
PHH0853-01 10 µg

Recombinant Human IgG4 Fc (224AA)

Sign In for Pricing
View Details
Recombinant Human IgG4 Fc (224AA)
PHH0853-02 50 µg

Recombinant Human IgG4 Fc (224AA)

Sign In for Pricing
View Details
Recombinant Human IgG4 Fc (224AA)
PHH0853-03 500 µg

Recombinant Human IgG4 Fc (224AA)

Sign In for Pricing
View Details
CLPX Protein Vector (Mouse) (pPB-C-His)
PV166394 500 ng

CLPX Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details