Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HBZ protein

This Human HBZ protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBAZ Hemoglobin zeta chain Zeta-globin

UniProt

P02008

Expression Region

1-142aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-252AA: 1-142AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIAF Antibody
3490-100 100 µg

FIAF Antibody

Sign In for Pricing
View Details
Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag
049485-01 10 µg

Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag
049485-02 50 µg

Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag
049485-03 100 µg

Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag
049485-04 200 µg

Eukaryotic Interleukin 10 (IL10), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Dof zinc finger protein DOF4.6 (DOF4.6)
MBS1394930-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Dof zinc finger protein DOF4.6 (DOF4.6)

Sign In for Pricing
View Details