Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HBZ protein

This Human HBZ protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBAZ Hemoglobin zeta chain Zeta-globin

UniProt

P02008

Expression Region

1-142aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-252AA: 1-142AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN18 Polyclonal Antibody
orb618455-01 50 μL

PTPN18 Polyclonal Antibody

Sign In for Pricing
View Details
PTPN18 Polyclonal Antibody
orb618455-02 100 µL

PTPN18 Polyclonal Antibody

Sign In for Pricing
View Details
CNIH4 Protein Vector (Mouse) (pPB-C-His)
PV166662 500 ng

CNIH4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
C1orf148 Antibody Blocking Peptide
orb1511993 500 µg

C1orf148 Antibody Blocking Peptide

Sign In for Pricing
View Details
NR2E3 Antibody
orb1330255 100 µg

NR2E3 Antibody

Sign In for Pricing
View Details
ELISA Kit for Heat Shock Protein 90 (HSP90)
TRV-0049444-01 24 Tests

ELISA Kit for Heat Shock Protein 90 (HSP90)

Sign In for Pricing
View Details