Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDXK protein

This Human PDXK protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyridoxine kinase

UniProt

O00764

Expression Region

1-312aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-325AA: 1-312AAFull Length of BC005341 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK6 Antibody : HRP (OAAF02506-HRP)
OAAF02506-100UG-HRP 100 µg

DOK6 Antibody : HRP (OAAF02506-HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal ENPP-2/Autotaxin Antibody [FITC]
NBP2-98332F 0.1 mL

Rabbit Polyclonal ENPP-2/Autotaxin Antibody [FITC]

Sign In for Pricing
View Details
Topors sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4948703 1.0 µg DNA

Topors sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal ALDH4A1 Antibody (002) [DyLight 550]
NBP2-90152R 0.1 mL

Rabbit Monoclonal ALDH4A1 Antibody (002) [DyLight 550]

Sign In for Pricing
View Details
Rabbit anti-Axin-1 Antibody
DL92025A-01 50 µL

Rabbit anti-Axin-1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Axin-1 Antibody
DL92025A-02 100 µL

Rabbit anti-Axin-1 Antibody

Sign In for Pricing
View Details