Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCAS2 protein

This Human BCAS2 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Breast carcinoma-amplified sequence 2 DNA amplified in mammary carcinoma 1 protein Spliceosome-associated protein SPF 27

UniProt

O75934

Expression Region

1-225aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-185AA: 1-225AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KvBeta1 Antibody (OTI7F12) [PE/Cy5.5]
NBP2-71349PECY55 0.1 mL

Mouse Monoclonal KvBeta1 Antibody (OTI7F12) [PE/Cy5.5]

Sign In for Pricing
View Details
RAB19 Antibody
E19-9816-1 50 µg - 50 µL

RAB19 Antibody

Sign In for Pricing
View Details
Bora (NM_001013997) Rat Tagged Lenti ORF Clone
RR213677L4 10 µg

Bora (NM_001013997) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SUV39H2 Antibody
orb1285229 100 µL

SUV39H2 Antibody

Sign In for Pricing
View Details
Human PRKCA knockout cell line
ABC-KH12144 1 Vial

Human PRKCA knockout cell line

Sign In for Pricing
View Details
Tph2 sgRNA CRISPR Lentivector set (Mouse)
K4118401 3x 1.0 µg

Tph2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details